CJC-1295 (No DAC) 5MG

CJC-1295 (No DAC), commonly referred to as Modified GRF (1-29), is a synthetic 29-amino-acid research peptide supplied for controlled laboratory, analytical, and scientific research.

This form does not contain the Drug Affinity Complex (DAC) modification associated with CJC-1295 with DAC. Because the two materials are chemically distinct, they should not share the same molecular specifications or be treated as interchangeable in technical documentation.

CJC-1295 (No DAC) contains defined amino-acid substitutions and a C-terminal amide, making sequence integrity, stereochemistry, and terminal modification important components of its analytical identity.

Research Applications

CJC-1295 (No DAC) may be examined in controlled non-clinical research involving:

• Modified peptide characterization
• Ligand-receptor interaction studies
• Molecular signaling research
• Structure-function analysis
• Analytical peptide comparison
• Stability assessment
• Non-clinical biochemical and cellular models

Experimental findings should remain limited to the applicable research system and should not be interpreted as evidence of hormonal benefit, performance enhancement, therapeutic effectiveness, or suitability for human use.

Structural Information

CJC-1295 (No DAC) is commonly represented as:

Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH₂

One-letter representation:

YADAIFTQSYRKVLAQLSARKLLQDILSR-NH₂

Important structural characteristics include:

• 29 amino-acid residues
• D-Ala substitution
• C-terminal amidation
• No DAC linker or maleimide modification

Because nomenclature around CJC-1295 No DAC / Mod GRF 1-29 has historically been inconsistent across catalogs, the exact sequence and molecular specifications should be confirmed against the applicable Certificate of Analysis.

Analytical Identification

Relevant analytical characterization may include:

• Amino-acid sequence confirmation
• D-residue verification
• C-terminal amidation confirmation
• Molecular mass assessment
• Chromatographic purity testing
• Peptide identity verification
• Structural characterization
• Lot-specific quality testing

Specifications & Documentation

Lot-specific documentation should be reviewed for:

• Exact peptide identity
• Amino-acid sequence
• CAS reference
• Molecular formula
• Molecular weight
• Modified residues
• Terminal modification
• Confirmation of no DAC modification
• Salt or counter-ion form
• Purity specification
• Analytical testing
• Lot or batch identification
• Certificate of Analysis
• Storage requirements

Authenticated product-specific documentation should take precedence over generalized catalog values.

Storage & Handling

Store according to the conditions specified on the product label and Certificate of Analysis. Protect the material from environmental conditions that could compromise peptide integrity.

Handling should follow established laboratory procedures appropriate for modified research peptide materials.

Research Use Only

CJC-1295 (No DAC) is supplied exclusively for laboratory research, analytical testing, and scientific reference purposes.

Disclaimer

For research use only. Not for human or veterinary use. Not intended for consumption, administration, hormonal use, performance enhancement, diagnosis, treatment, mitigation, cure, or prevention of any disease. No therapeutic, hormonal, performance-related, medical, or clinical claims are made or implied. Product information is supplied solely for scientific identification, documentation, and research reference.