Sermorelin 10MG
Sermorelin 10mg is a synthetic 29-amino-acid research peptide supplied for controlled laboratory, analytical, and scientific research.
Its structure corresponds to an amidated 29-residue peptide sequence. The C-terminal amide forms part of the compound’s defined molecular identity and should be retained in accurate sequence and molecular documentation.
PubChem lists Sermorelin with molecular formula C₁₄₉H₂₄₆N₄₄O₄₂S, molecular weight approximately 3357.9 g/mol, and sequence YADAIFTNSYRKVLGQLSARKLLQDIMSR with C-terminal amidation.
Research Applications
Sermorelin may be examined in controlled non-clinical research involving:
- Peptide identity and characterization
- Ligand-receptor interaction studies
- Molecular signaling research
- Structure-function analysis
- Analytical peptide comparison
- Stability assessment
- Non-clinical biochemical and cellular models
Any experimental observations should remain specific to the applicable research system and should not be interpreted as evidence of hormonal benefit, therapeutic effectiveness, performance enhancement, or suitability for human use.
Structural Information
Sermorelin is represented as:
H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH₂
One-letter representation:
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂
The C-terminal amidation distinguishes Sermorelin from the corresponding non-amidated GHRH (1-29) peptide. PubChem lists the non-amidated GHRH (1-29) separately with molecular formula C₁₄₉H₂₄₅N₄₃O₄₃S and M.W. 3358.9 g/mol.
Analytical Identification
Relevant analytical characterization may include:
- Amino-acid sequence confirmation
- C-terminal amidation verification
- Molecular mass assessment
- Chromatographic purity testing
- Peptide identity verification
- Structural characterization
- Lot-specific quality testing
Specifications & Documentation
Lot-specific documentation should be reviewed for:
- Compound identity
- Labeled 10 mg content
- Amino-acid sequence
- Molecular formula
- Molecular weight
- Terminal modification
- Salt or counter-ion form
- Purity specification
- Analytical testing
- Lot or batch identification
- Certificate of Analysis
- Storage requirements
Authenticated product-specific documentation should take precedence over generalized reference values.
Storage & Handling
Store according to the conditions specified on the product label and Certificate of Analysis. Protect the material from environmental conditions that could compromise peptide integrity.
Handling should follow established laboratory procedures appropriate for research materials.
Research Use Only
Sermorelin 10mg is supplied exclusively for laboratory research, analytical testing, and scientific reference purposes.
Disclaimer
For research use only. Not for human or veterinary use. Not intended for consumption, administration, hormonal use, performance enhancement, diagnosis, treatment, mitigation, cure, or prevention of any disease. No therapeutic, hormonal, performance-related, medical, or clinical claims are made or implied. Product information is supplied solely for scientific identification, documentation, and research reference.
$ 99
Sermorelin 10mg is a synthetic 29-amino-acid research peptide supplied for controlled laboratory, analytical, and scientific research.
Its structure corresponds to an amidated 29-residue peptide sequence. The C-terminal amide forms part of the compound’s defined molecular identity and should be retained in accurate sequence and molecular documentation.
PubChem lists Sermorelin with molecular formula C₁₄₉H₂₄₆N₄₄O₄₂S, molecular weight approximately 3357.9 g/mol, and sequence YADAIFTNSYRKVLGQLSARKLLQDIMSR with C-terminal amidation.
Research Applications
Sermorelin may be examined in controlled non-clinical research involving:
- Peptide identity and characterization
- Ligand-receptor interaction studies
- Molecular signaling research
- Structure-function analysis
- Analytical peptide comparison
- Stability assessment
- Non-clinical biochemical and cellular models
Any experimental observations should remain specific to the applicable research system and should not be interpreted as evidence of hormonal benefit, therapeutic effectiveness, performance enhancement, or suitability for human use.
Structural Information
Sermorelin is represented as:
H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH₂
One-letter representation:
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂
The C-terminal amidation distinguishes Sermorelin from the corresponding non-amidated GHRH (1-29) peptide. PubChem lists the non-amidated GHRH (1-29) separately with molecular formula C₁₄₉H₂₄₅N₄₃O₄₃S and M.W. 3358.9 g/mol.
Analytical Identification
Relevant analytical characterization may include:
- Amino-acid sequence confirmation
- C-terminal amidation verification
- Molecular mass assessment
- Chromatographic purity testing
- Peptide identity verification
- Structural characterization
- Lot-specific quality testing
Specifications & Documentation
Lot-specific documentation should be reviewed for:
- Compound identity
- Labeled 10 mg content
- Amino-acid sequence
- Molecular formula
- Molecular weight
- Terminal modification
- Salt or counter-ion form
- Purity specification
- Analytical testing
- Lot or batch identification
- Certificate of Analysis
- Storage requirements
Authenticated product-specific documentation should take precedence over generalized reference values.
Storage & Handling
Store according to the conditions specified on the product label and Certificate of Analysis. Protect the material from environmental conditions that could compromise peptide integrity.
Handling should follow established laboratory procedures appropriate for research materials.
Research Use Only
Sermorelin 10mg is supplied exclusively for laboratory research, analytical testing, and scientific reference purposes.
Disclaimer
For research use only. Not for human or veterinary use. Not intended for consumption, administration, hormonal use, performance enhancement, diagnosis, treatment, mitigation, cure, or prevention of any disease. No therapeutic, hormonal, performance-related, medical, or clinical claims are made or implied. Product information is supplied solely for scientific identification, documentation, and research reference.
Related Products
Related products
// FAQ's //
Current Offers on Selected Research Materials Materials
Review active pricing on selected Research Materials for Laboratory Use while product availability and promotional terms remain in effect.
No. All products are supplied exclusively for laboratory research. They are not intended for human or veterinary use, personal use, diagnostic procedures, or therapeutic applications.
Yes. Our checkout process uses secure technology to help protect your personal and payment information. Available payment methods may vary depending on your location and order details.
Relevant product pages may include recommended Storage Conditions and Handling Guidelines. Researchers remain responsible for using appropriate equipment, facilities, procedures, and internal laboratory controls.
Eligible customers may Order Research Compounds Online, subject to product availability, location restrictions, website terms, and any applicable order-verification requirements.
No. Steady labs does not provide patient consultations, medical advice, dosing guidance, treatment recommendations, or instructions for personal use.
Research grade describes material supplied for controlled laboratory investigation with relevant specifications or available analytical information. It does not indicate pharmaceutical approval, suitability for consumption, or authorization for clinical use.
Reviews
There are no reviews yet.