LL-37 5 MG

LL-37 is a synthetic 37-amino-acid peptide supplied for controlled laboratory, analytical, and scientific research.

Its defined linear sequence and molecular composition support research involving peptide identity, structural characterization, molecular interaction studies, membrane-associated biochemical systems, and comparative analytical work.

For accurate technical documentation, the exact chemical form, terminal state, counter-ion status, purity specification, and lot-specific analytical profile should be confirmed using the applicable Certificate of Analysis.

Research Applications

LL-37 may be examined in controlled non-clinical research involving:

• Peptide identity and characterization
• Molecular interaction studies
• Membrane-associated biochemical research
• Structure-function analysis
• Analytical peptide comparison
• Stability assessment
• Non-clinical biochemical and cellular models

Any experimental findings should remain specific to the applicable research system and should not be interpreted as evidence of antimicrobial treatment, immune benefit, wound-related benefit, therapeutic effectiveness, or clinical suitability.

Structural Information

LL-37 consists of 37 amino-acid residues:

[LL-37, 37 aa]

Expanded representation:

Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser

The parent research peptide is commonly represented with free terminal groups unless otherwise specified by the manufacturer or Certificate of Analysis.

Analytical Identification

Relevant analytical characterization may include:

• Amino-acid sequence confirmation
• Molecular mass assessment
• Chromatographic purity testing
• Peptide identity verification
• Structural characterization
• Terminal-state confirmation
• Lot-specific quality testing

If the material is supplied as a TFA, acetate, or another counter-ion form, molecular specifications should be matched to that exact preparation.

Specifications & Documentation

Lot-specific documentation should be reviewed for:

• Compound identity
• Amino-acid sequence
• Molecular formula
• Molecular weight
• Terminal form
• Salt or counter-ion form
• Purity specification
• Analytical testing
• Lot or batch identification
• Certificate of Analysis
• Storage requirements

Authenticated product-specific documentation should take precedence over generalized reference values.

Storage & Handling

Store according to the conditions specified on the product label and Certificate of Analysis. Protect the material from environmental conditions that could compromise peptide integrity.

Handling should follow established laboratory procedures appropriate for research peptide materials.

Research Use Only

LL-37 is supplied exclusively for laboratory research, analytical testing, and scientific reference purposes.

Disclaimer

For research use only. Not for human or veterinary use. Not intended for consumption, administration, antimicrobial use, immune-related use, wound-related use, diagnosis, treatment, mitigation, cure, or prevention of any disease. No antimicrobial, therapeutic, immune-related, regenerative, medical, or clinical claims are made or implied. Product information is supplied solely for scientific identification, documentation, and research reference.